GO APE - HIGH ROPES OUTDOOR ACTIVITIES Go Ape is open, pre-booking is essential. The UK's #1 Outdoor Adventure company located at 34 stunning UK locations. Go Ape is home to 9 high rope and and forest floor activities including Treetop Challenge, Treetop Adventure, Forest Segways and Axe Throwing. We also offer Large Group and School events as well as Gift Vouchers and Children's Birthday Parties! ADVENTURES AT LOCATIONS AND FORESTS ACROSS THE UK London. Battersea Park. An urban twist on treetop fun located in the heart of the capital at Battersea Park. 889 reviews. South East. Bedgebury. Bedgebury offers you a world-renowned setting to your Go Ape experience. Enjoy a treetop view of one of the largest collections of conifers in the world. 1154 reviews. GO APE FOREST OF DEAN Nestled in the English Westcountry you'll find the idyllic Forest of Dean. It's towering pines and ancient oaks provide a home to some of the country's most treasured wildlife and not one, but two awesome Go Ape locations.. Beechenhurst is located near Speech House Hotel and is the hub for families and young adventurers.Mallards Pike is located further south within the forest by the beautiful FIND ADVENTURE IN COVENTRY, WEST MIDLANDS Coventry. Opened in Spring 2019, Go Ape Coventry offers the best of high rope antics. With a Treetop Challenge, Treetop Adventure Plus and Treetop Adventure, this location has something for thrill-seeking adults and fun-seeking children. This is a challenging but sociable course which packs a punch featuring a Tarzan Swing and 200 metre dual FIND ADVENTURE IN SHERWOOD PINES, NR NOTTINGHAM Sherwood. Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course where the tandem zip wire speedometer can hit 20 mph. Kids are spoilt for choice with a Treetop Adventure course and one of the only two Nets Adventures in the UK. Decisions, decisions. FIND ADVENTURE IN ABERDEEN, SCOTLAND Aberdeen. Go Ape Aberdeen is in the heart of Aberdeenshire. The stunning landscape offers you everything from mountain to sea and against a backdrop which delivers big (we’ve gone big too on this Treetop Challenge). In the grounds of this 16th century castle we’ll take you deep into the forest. FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock. This Go Ape location hits all the fun and adventure buttons against a backdrop of stunning valley views. In an area of Outstanding Natural Beauty you’ll find the longest combined crossing of any Go Ape location with nearly 1,500 metres of tree-to-tree crossings on our Challenge course. The Treetop Adventure course is ideal for FIND ADVENTURE IN NORMANBY HALL, NR SCUNTHORPE Normanby Hall Country Park is situated north of Scunthorpe just off the A1077. It is easily accessible from the M180 and from Hull. It is signposted from the M180 and the Humber Bridge. Parking charges are up to £4 per day. Please note that the country park is no accepting cash payments at this time. FIND ADVENTURE IN SOUTHAMPTON, HAMPSHIRE From Eastleigh: Take the A355 to Southampton airport. Follow brown tourist signs to Itchen Valley Country Park, past the airport onto A27. You'll find Go Ape in the furthest car park. We are tucked away in the corner! Please note that the following parking charges apply: Up to 1 hour £1.50. Up to 2 hours £2.80.

NETS ADVENTURE

Nets Adventure. Nets Adventure is a wonderworld of treetop nets, trampolines and netted tunnels. An expansive network of four huge bounce nets spread out over three different levels, this is treetop heaven for children (and adults). Use the multi-level tower hub to access the huge nets, and climb on up to the observation deck at the

top to view

GO APE - HIGH ROPES OUTDOOR ACTIVITIES Go Ape is open, pre-booking is essential. The UK's #1 Outdoor Adventure company located at 34 stunning UK locations. Go Ape is home to 9 high rope and and forest floor activities including Treetop Challenge, Treetop Adventure, Forest Segways and Axe Throwing. We also offer Large Group and School events as well as Gift Vouchers and Children's Birthday Parties! ADVENTURES AT LOCATIONS AND FORESTS ACROSS THE UK London. Battersea Park. An urban twist on treetop fun located in the heart of the capital at Battersea Park. 889 reviews. South East. Bedgebury. Bedgebury offers you a world-renowned setting to your Go Ape experience. Enjoy a treetop view of one of the largest collections of conifers in the world. 1154 reviews. GO APE FOREST OF DEAN Nestled in the English Westcountry you'll find the idyllic Forest of Dean. It's towering pines and ancient oaks provide a home to some of the country's most treasured wildlife and not one, but two awesome Go Ape locations.. Beechenhurst is located near Speech House Hotel and is the hub for families and young adventurers.Mallards Pike is located further south within the forest by the beautiful FIND ADVENTURE IN COVENTRY, WEST MIDLANDS Coventry. Opened in Spring 2019, Go Ape Coventry offers the best of high rope antics. With a Treetop Challenge, Treetop Adventure Plus and Treetop Adventure, this location has something for thrill-seeking adults and fun-seeking children. This is a challenging but sociable course which packs a punch featuring a Tarzan Swing and 200 metre dual FIND ADVENTURE IN SHERWOOD PINES, NR NOTTINGHAM Sherwood. Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course where the tandem zip wire speedometer can hit 20 mph. Kids are spoilt for choice with a Treetop Adventure course and one of the only two Nets Adventures in the UK. Decisions, decisions. FIND ADVENTURE IN ABERDEEN, SCOTLAND Aberdeen. Go Ape Aberdeen is in the heart of Aberdeenshire. The stunning landscape offers you everything from mountain to sea and against a backdrop which delivers big (we’ve gone big too on this Treetop Challenge). In the grounds of this 16th century castle we’ll take you deep into the forest. FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock. This Go Ape location hits all the fun and adventure buttons against a backdrop of stunning valley views. In an area of Outstanding Natural Beauty you’ll find the longest combined crossing of any Go Ape location with nearly 1,500 metres of tree-to-tree crossings on our Challenge course. The Treetop Adventure course is ideal for FIND ADVENTURE IN NORMANBY HALL, NR SCUNTHORPE Normanby Hall Country Park is situated north of Scunthorpe just off the A1077. It is easily accessible from the M180 and from Hull. It is signposted from the M180 and the Humber Bridge. Parking charges are up to £4 per day. Please note that the country park is no accepting cash payments at this time. FIND ADVENTURE IN SOUTHAMPTON, HAMPSHIRE From Eastleigh: Take the A355 to Southampton airport. Follow brown tourist signs to Itchen Valley Country Park, past the airport onto A27. You'll find Go Ape in the furthest car park. We are tucked away in the corner! Please note that the following parking charges apply: Up to 1 hour £1.50. Up to 2 hours £2.80.

NETS ADVENTURE

Nets Adventure. Nets Adventure is a wonderworld of treetop nets, trampolines and netted tunnels. An expansive network of four huge bounce nets spread out over three different levels, this is treetop heaven for children (and adults). Use the multi-level tower hub to access the huge nets, and climb on up to the observation deck at the

top to view

GO APE DALKEITH OPENING SUMMER 2021 Go Ape Dalkeith will be Go Ape's 35 location in the UK. Opening Summer

2021.

GO APE FOREST OF DEAN Nestled in the English Westcountry you'll find the idyllic Forest of Dean. It's towering pines and ancient oaks provide a home to some of the country's most treasured wildlife and not one, but two awesome Go Ape locations.. Beechenhurst is located near Speech House Hotel and is the hub for families and young adventurers.Mallards Pike is located further south within the forest by the beautiful FIND ADVENTURE IN BUXTON, DERBYSHIRE The smallest Area of Outstanding Natural Beauty in mainland Britain, delivering big on treetop fun and adventure. Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course FIND ADVENTURE IN CRAWLEY, WEST SUSSEX Crawley Go Ape is located in Tilgate Park, 162 hectares to the south of Crawley. The park is jammed packed with things to do once you set your feet down on terra firma. Have a breather and refuel in the Walled Garden café, before heading out to explore the heritage parkland and Nature Centre. You’ll find beautiful lawns, lakes,

heather

WIN A CLIFF CAMPING EXPERIENCE Win an unforgettable night for two camping on a Dorset cliff face. Including breakfast and dinner, you'll enjoy stunning views on this camping trip you'll never forget. FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock. This Go Ape location hits all the fun and adventure buttons against a backdrop of stunning valley views. In an area of Outstanding Natural Beauty you’ll find the longest combined crossing of any Go Ape location with nearly 1,500 metres of tree-to-tree crossings on our Challenge course. The Treetop Adventure course is ideal for SCHOOL TRIPS FOR PRIMARY SCHOOLS Children leave taller, stronger and more resilient after a primary school visit. Available at 24 locations across the UK, you really can take learning outside the classroom. Prices start from £12 per schoolchild* and required supervisors go free. FIND ADVENTURE IN RIVINGTON, NR BOLTON, LANCASHIRE Rivington. Hailed the mini Lake District of Manchester, Rivington is a perfect location for Go Ape. With its rugged hills, picturesque reservoirs and woodland bustling with wildlife, it has proved to be a hit with adrenaline lovers who enjoy a whole day out. On the edge of the moors, there’s a wonderful sense of wilderness to Rivington Go

Ape.

DAYS OUT WITH THE KIDS Suitable for ages: 10 years + & Teenagers. For kids over the age of 10 an even bigger adventure awaits. This classic Go Ape experience features full-scale obstacles and crossings for older children and grown-up's to tackle. The course includes one of our most popular FIND ADVENTURE IN WENDOVER, NR AYLESBURY, BUCKS Its not-to-be-sniffed-at Go Ape claim to fame is the optional Extreme Route featuring a climbing wall and scramble net that are certain to be a memorable part of your day out. The Treetop Adventure packs a punch too. Officially one of our hardest adventure courses there’s 429-metres of high rope crossings and a cracking 85-metre zip wire

finale.

GO APE - HIGH ROPES OUTDOOR ACTIVITIES Go Ape is open, pre-booking is essential. The UK's #1 Outdoor Adventure company located at 34 stunning UK locations. Go Ape is home to 9 high rope and and forest floor activities including Treetop Challenge, Treetop Adventure, Forest Segways and Axe Throwing. We also offer Large Group and School events as well as Gift Vouchers and Children's Birthday Parties! FIND ADVENTURE IN BUXTON, DERBYSHIRE Just the journey in to Buxton Go Ape, through the beautiful Peak District National Park, will set the scene of what awaits you. Conveniently located within walking distance from the historic spa town of Buxton, and just under an hour’s drive from Sheffield city centre, you can spend the whole day in England’s largest and oldest

national park.

FIND ADVENTURE IN SHERWOOD PINES, NR NOTTINGHAM Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course where the tandem zip wire speedometer can hit 20 mph. Kids are spoilt for choice with a Treetop Adventure course and one of FIND ADVENTURE IN WENDOVER, NR AYLESBURY, BUCKS Just 23 miles from Oxford, Go Ape Wendover has both a kids' high ropes course and one of our most challenging adults' courses, featuring an optional 'Extreme Route'. FIND ADVENTURE IN COVENTRY, WEST MIDLANDS Opened in Spring 2019, Go Ape Coventry offers the best of high rope antics. With a Treetop Challenge, Treetop Adventure Plus and Treetop Adventure, this location has something for thrill-seeking adults and fun-seeking children. FIND ADVENTURE IN SOUTHAMPTON, HAMPSHIRE You’ll find Go Ape Southampton in Itchen Valley Country Park. This 440 acres of beautiful water meadows, woodland and meadows are situated beside the River Itchen and has been recognised by the award of a Green Flag for the past four years. FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock Chase is the smallest Area of Outstanding Beauty in mainland Britain and promises to deliver big time fun and adventure. Within an hours’ drive of Birmingham, a stone's throw away from Trentham and easy to reach distance from Leicester, it’s the perfect opportunity to escape the city for the day! FIND ADVENTURE IN BRACKNELL, BERKSHIRE There’s triple fun to be had at Bracknell Go Ape with three of our fan favourites – Treetop Challenge, Treetop Adventure and Forest Segway. We’ve got all views of HIGH ROPES ADVENTURE IN BATTERSEA PARK, LONDON Our most central forest experience in London. This is big outdoor fun in the big city with spectacular views across Battersea and the park. There's more to this stacked course than meets the eye with people above, below and all around you. FIND ADVENTURE IN CRAWLEY, WEST SUSSEX Our Crawley site is located at Tilgate Park, a few minutes’ drive from the town centre and only a 40-minute drive from Brighton. Set within a park containing a lake, extensive woodlands, multiple activities and a themed restaurant, there is plenty to do. GO APE - HIGH ROPES OUTDOOR ACTIVITIES Go Ape is open, pre-booking is essential. The UK's #1 Outdoor Adventure company located at 34 stunning UK locations. Go Ape is home to 9 high rope and and forest floor activities including Treetop Challenge, Treetop Adventure, Forest Segways and Axe Throwing. We also offer Large Group and School events as well as Gift Vouchers and Children's Birthday Parties! FIND ADVENTURE IN BUXTON, DERBYSHIRE Just the journey in to Buxton Go Ape, through the beautiful Peak District National Park, will set the scene of what awaits you. Conveniently located within walking distance from the historic spa town of Buxton, and just under an hour’s drive from Sheffield city centre, you can spend the whole day in England’s largest and oldest

national park.

FIND ADVENTURE IN SHERWOOD PINES, NR NOTTINGHAM Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course where the tandem zip wire speedometer can hit 20 mph. Kids are spoilt for choice with a Treetop Adventure course and one of FIND ADVENTURE IN WENDOVER, NR AYLESBURY, BUCKS Just 23 miles from Oxford, Go Ape Wendover has both a kids' high ropes course and one of our most challenging adults' courses, featuring an optional 'Extreme Route'. FIND ADVENTURE IN COVENTRY, WEST MIDLANDS Opened in Spring 2019, Go Ape Coventry offers the best of high rope antics. With a Treetop Challenge, Treetop Adventure Plus and Treetop Adventure, this location has something for thrill-seeking adults and fun-seeking children. FIND ADVENTURE IN SOUTHAMPTON, HAMPSHIRE You’ll find Go Ape Southampton in Itchen Valley Country Park. This 440 acres of beautiful water meadows, woodland and meadows are situated beside the River Itchen and has been recognised by the award of a Green Flag for the past four years. FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock Chase is the smallest Area of Outstanding Beauty in mainland Britain and promises to deliver big time fun and adventure. Within an hours’ drive of Birmingham, a stone's throw away from Trentham and easy to reach distance from Leicester, it’s the perfect opportunity to escape the city for the day! FIND ADVENTURE IN BRACKNELL, BERKSHIRE There’s triple fun to be had at Bracknell Go Ape with three of our fan favourites – Treetop Challenge, Treetop Adventure and Forest Segway. We’ve got all views of HIGH ROPES ADVENTURE IN BATTERSEA PARK, LONDON Our most central forest experience in London. This is big outdoor fun in the big city with spectacular views across Battersea and the park. There's more to this stacked course than meets the eye with people above, below and all around you. FIND ADVENTURE IN CRAWLEY, WEST SUSSEX Our Crawley site is located at Tilgate Park, a few minutes’ drive from the town centre and only a 40-minute drive from Brighton. Set within a park containing a lake, extensive woodlands, multiple activities and a themed restaurant, there is plenty to do. FIND AN OUTDOOR ADVENTURE IN WALES Home to our biggest Tarzan Swing with an incredible 6m free fall, find

a Go Ape in Wales.

BOOK YOUR ADVENTURE TODAY Book a Go Ape Adventure and choose from a variety of activities from Treetop Challenge to Axe Throwing at 34 incredible and unique UK

locations.

WIN A CLIFF CAMPING EXPERIENCE Win an unforgettable night for two camping on a Dorset cliff face. Including breakfast and dinner, you'll enjoy stunning views on this camping trip you'll never forget. FIND ADVENTURE IN WENDOVER, NR AYLESBURY, BUCKS Just 23 miles from Oxford, Go Ape Wendover has both a kids' high ropes course and one of our most challenging adults' courses, featuring an optional 'Extreme Route'. FIND ADVENTURE IN ABERFOYLE, NEAR GLASGOW, SCOTLAND If all this activity gives you an appetite, then t here’s a café to grab some food and drink.. There's also an impressive Lodge Forest Visitor Centre with live CCTV viewing so you can get up close to a wide range of wildlife, and a red squirrel hide within easy strolling distance. If you’re thinking you’re going to need more than one day to enjoy all this fabulous park has to offer then GO APE DALKEITH OPENING SUMMER 2021 Go Ape Dalkeith will be Go Ape's 35 location in the UK. Opening Summer

2021.

FIND ADVENTURE IN MARGAM, NR SWANSEA, WALES Experience our brand new Electric Scooters, put them to the test in Margam's Country Park. Perfect for the adrenaline junkie. Less than 25 miles from Cardiff and just down the road from Swansea, Go Ape Margam boasts the UK's biggest Tarzan Swing! FIND ADVENTURE IN DALBY FOREST, NORTH YORKSHIRE Go Ape Dalby is an adventurer’s paradise. We’ve set the thrill factor to the max with a jaw-dropping Treetop Challenge, Treetop Adventure, plus Forest Segways all located in Dalby Forest. FIND ADVENTURE IN TEMPLE NEWSAM, NEAR LEEDS There’s a stately feel to Go Ape Temple Newsam, despite being situated just four miles from the centre of Leeds. Based in estate grounds with a 500-year-old country mansion and beautiful woodlands, you’ll feel like Lord and Lady. FIND ADVENTURE AT BEECHENHURST, FOREST OF DEAN, GLOUCESTER Sandwiched between the River Severn and the River Wye you’ll find Beechenhurst, Forest of Dean This peaceful location is home to our Forest of Dean Treetop Adventure course so bring the whole family for some giggles and fun on our high ropes course.With great views and lots of other opportunities to keep you busy this location is ideal for making special memories with younger age groups. GO APE - HIGH ROPES OUTDOOR ACTIVITIES Go Ape is open, pre-booking is essential. The UK's #1 Outdoor Adventure company located at 34 stunning UK locations. Go Ape is home to 9 high rope and and forest floor activities including Treetop Challenge, Treetop Adventure, Forest Segways and Axe Throwing. We also offer Large Group and School events as well as Gift Vouchers and Children's Birthday Parties! FIND ADVENTURE IN BUXTON, DERBYSHIRE The smallest Area of Outstanding Natural Beauty in mainland Britain, delivering big on treetop fun and adventure. Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course FIND ADVENTURE IN CRAWLEY, WEST SUSSEX Crawley Go Ape is located in Tilgate Park, 162 hectares to the south of Crawley. The park is jammed packed with things to do once you set your feet down on terra firma. Have a breather and refuel in the Walled Garden café, before heading out to explore the heritage parkland and Nature Centre. You’ll find beautiful lawns, lakes,

heather

FIND ADVENTURE IN COVENTRY, WEST MIDLANDS Coventry. Opened in Spring 2019, Go Ape Coventry offers the best of high rope antics. With a Treetop Challenge, Treetop Adventure Plus and Treetop Adventure, this location has something for thrill-seeking adults and fun-seeking children. This is a challenging but sociable course which packs a punch featuring a Tarzan Swing and 200 metre dual FIND ADVENTURE IN NORMANBY HALL, NR SCUNTHORPE The Goliath of our high ropes adventures. Daredevils and thrill seekers will certainly find something to challenge them on our challenge course. fierce. Go Moderate. duration. 2-3 FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock. This Go Ape location hits all the fun and adventure buttons against a backdrop of stunning valley views. In an area of Outstanding Natural Beauty you’ll find the longest combined crossing of any Go Ape location with nearly 1,500 metres of tree-to-tree crossings on our Challenge course. The Treetop Adventure course is ideal for FIND ADVENTURE IN SHERWOOD PINES, NR NOTTINGHAM Sherwood. Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course where the tandem zip wire speedometer can hit 20 mph. Kids are spoilt for choice with a Treetop Adventure course and one of the only two Nets Adventures in the UK. Decisions, decisions. FIND ADVENTURE IN WENDOVER, NR AYLESBURY, BUCKS Its not-to-be-sniffed-at Go Ape claim to fame is the optional Extreme Route featuring a climbing wall and scramble net that are certain to be a memorable part of your day out. The Treetop Adventure packs a punch too. Officially one of our hardest adventure courses there’s 429-metres of high rope crossings and a cracking 85-metre zip wire

finale.

FIND ADVENTURE IN DELAMERE FOREST, NR CHESTER Delamere. Delemere Forest is home to 3 awesome Go Ape activities for adventurers of all ages. Young children finding their footing and over 1m tall will have the best day out tackling Treetop Adventure. We recommend Treetop Challenge for older children, teens and adult adventurers. Battle your way from tree to tree on the Challenge

course.

NETS ADVENTURE

Nets Adventure is a wonderworld of treetop nets, trampolines and much more. This is treetop heaven for children (and adults) with four huge bounce nets (one filled with giant balls and one just for kids), seven canopy tree houses and one destination tree house. GO APE - HIGH ROPES OUTDOOR ACTIVITIES Go Ape is open, pre-booking is essential. The UK's #1 Outdoor Adventure company located at 34 stunning UK locations. Go Ape is home to 9 high rope and and forest floor activities including Treetop Challenge, Treetop Adventure, Forest Segways and Axe Throwing. We also offer Large Group and School events as well as Gift Vouchers and Children's Birthday Parties! FIND ADVENTURE IN BUXTON, DERBYSHIRE The smallest Area of Outstanding Natural Beauty in mainland Britain, delivering big on treetop fun and adventure. Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course FIND ADVENTURE IN CRAWLEY, WEST SUSSEX Crawley Go Ape is located in Tilgate Park, 162 hectares to the south of Crawley. The park is jammed packed with things to do once you set your feet down on terra firma. Have a breather and refuel in the Walled Garden café, before heading out to explore the heritage parkland and Nature Centre. You’ll find beautiful lawns, lakes,

heather

FIND ADVENTURE IN COVENTRY, WEST MIDLANDS Coventry. Opened in Spring 2019, Go Ape Coventry offers the best of high rope antics. With a Treetop Challenge, Treetop Adventure Plus and Treetop Adventure, this location has something for thrill-seeking adults and fun-seeking children. This is a challenging but sociable course which packs a punch featuring a Tarzan Swing and 200 metre dual FIND ADVENTURE IN NORMANBY HALL, NR SCUNTHORPE The Goliath of our high ropes adventures. Daredevils and thrill seekers will certainly find something to challenge them on our challenge course. fierce. Go Moderate. duration. 2-3 FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock. This Go Ape location hits all the fun and adventure buttons against a backdrop of stunning valley views. In an area of Outstanding Natural Beauty you’ll find the longest combined crossing of any Go Ape location with nearly 1,500 metres of tree-to-tree crossings on our Challenge course. The Treetop Adventure course is ideal for FIND ADVENTURE IN SHERWOOD PINES, NR NOTTINGHAM Sherwood. Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course where the tandem zip wire speedometer can hit 20 mph. Kids are spoilt for choice with a Treetop Adventure course and one of the only two Nets Adventures in the UK. Decisions, decisions. FIND ADVENTURE IN WENDOVER, NR AYLESBURY, BUCKS Its not-to-be-sniffed-at Go Ape claim to fame is the optional Extreme Route featuring a climbing wall and scramble net that are certain to be a memorable part of your day out. The Treetop Adventure packs a punch too. Officially one of our hardest adventure courses there’s 429-metres of high rope crossings and a cracking 85-metre zip wire

finale.

FIND ADVENTURE IN DELAMERE FOREST, NR CHESTER Delamere. Delemere Forest is home to 3 awesome Go Ape activities for adventurers of all ages. Young children finding their footing and over 1m tall will have the best day out tackling Treetop Adventure. We recommend Treetop Challenge for older children, teens and adult adventurers. Battle your way from tree to tree on the Challenge

course.

NETS ADVENTURE

Nets Adventure is a wonderworld of treetop nets, trampolines and much more. This is treetop heaven for children (and adults) with four huge bounce nets (one filled with giant balls and one just for kids), seven canopy tree houses and one destination tree house. ADVENTURES AT LOCATIONS AND FORESTS ACROSS THE UK London. Battersea Park. An urban twist on treetop fun located in the heart of the capital at Battersea Park. 889 reviews. South East. Bedgebury. Bedgebury offers you a world-renowned setting to your Go Ape experience. Enjoy a treetop view of one of the largest collections of conifers in the world. 1154 reviews. FIND ADVENTURE IN WYRE, WOCESTERSHIRE The Goliath of our high ropes adventures. Designed specifically for the adventurers, you can be sure that the high-rise zip wires and tough Stepping Stones on this high ropes course will put you through your paces. fierce. Go Moderate. duration. 2-3 hours. cost. From £30.

Treetop Adventure.

BOOK YOUR ADVENTURE TODAY 1 hour. cost-white. From £23. Treetop Adventure. This experience lasts one hour and is perfect for young adventurers and families looking for some jam-packed fun in the forest canopy. Ideal for young adventurers over 1m tall. wild-white. Go Easy. duration-white. FIND ADVENTURE IN LEEDS CASTLE, NR MAIDSTONE, KENT Harness-up and conquer the dizzying high ropes challenges offered at our Leeds Castle site, with an incredible 250-metre zipline. fierce. Go Moderate/Hard. duration. 2-3 hours. cost. From £30. Treetop Adventure Plus. An extension to our Treetop Adventure experience for older kids over 1.2m. FIND ADVENTURE IN HALDON FOREST, NR EXETER, DEVON Go Ape Haldon is the gateway to fun and adventure on the moors. You’ll find us 15-minutes from Exeter nestled in 3,500-acres of woodland. Whether sat on top of a tree or moving between sites on the course you’ll get to appreciate the beauty of the Dartmoor landscape. With its many walking and cycling trails it’s a busy

park, popular with

NETS ADVENTURE

Nets Adventure is now open and taking bookings! The ultimate adventure playground with sprinkles of some Go Ape magic. Treetop bouncy nets linked by walkways 30 feet above the forest floor. There are inflatable balls to up the bounce factor and super slides to bring you back down to earth in style. Welcome to Nets Adventure!

JOBS AT GO APE

We're a friendly bunch here at Go Ape, and we believe in rewarding our Tribe accordingly. As well as an exciting environment, we offer our employees a host of benefits including a company contributed pension, workplace nursery scheme, discounted shopping and more. FIND ADVENTURE IN DALBY FOREST, NORTH YORKSHIRE tackle the great yorkshire forest. Dalby Forest, located in the North Yorkshire Moors, is famous for its fierce terrains and far-reaching views which draw an international crowd. With over 8000 acres of woodland to explore – there’s something to keep everyone entertained. There are 13 walking trails, four running trails and six

cycling trails.

FIND ADVENTURE IN TEMPLE NEWSAM, NEAR LEEDS An aerial adventure trio. There’s a stately feel to Go Ape Temple Newsam, despite being situated just four miles from the centre of Leeds. Based in estate grounds with a 500-year-old country mansion and beautiful woodlands, you’ll feel like Lord and Lady. One of the many brilliant things about this course is that no matter how challenging FIND ADVENTURE IN ABERDEEN, SCOTLAND Wildlife fans can enjoy some nature spotting with a walk along the Coy Burn where they may see buzzards, herons and kingfishers. There’s a Wild Wood Adventure Play area for the children with the Green Lady’s Tower, a rock face challenge and a zip wire to zoom between the trees (please note this is free for National Trust for Scotland members and children under the age of 4 and £3 per GO APE - HIGH ROPES OUTDOOR ACTIVITIES Go Ape is open, pre-booking is essential. The UK's #1 Outdoor Adventure company located at 34 stunning UK locations. Go Ape is home to 9 high rope and and forest floor activities including Treetop Challenge, Treetop Adventure, Forest Segways and Axe Throwing. We also offer Large Group and School events as well as Gift Vouchers and Children's Birthday Parties! FIND ADVENTURE IN BUXTON, DERBYSHIRE Just the journey in to Buxton Go Ape, through the beautiful Peak District National Park, will set the scene of what awaits you. Conveniently located within walking distance from the historic spa town of Buxton, and just under an hour’s drive from Sheffield city centre, you can spend the whole day in England’s largest and oldest

national park.

FIND ADVENTURE IN COVENTRY, WEST MIDLANDS Opened in Spring 2019, Go Ape Coventry offers the best of high rope antics. With a Treetop Challenge, Treetop Adventure Plus and Treetop Adventure, this location has something for thrill-seeking adults and fun-seeking children. FIND ADVENTURE IN CRAWLEY, WEST SUSSEX Our Crawley site is located at Tilgate Park, a few minutes’ drive from the town centre and only a 40-minute drive from Brighton. Set within a park containing a lake, extensive woodlands, multiple activities and a themed restaurant, there is plenty to do. FIND ADVENTURE IN NORMANBY HALL, NR SCUNTHORPE Set in a beautiful 300 acre estate in North Lincolnshire, Go Ape Normamby Hall has two different difficulties available, including Tarzan Swings and Zip Wires. FIND ADVENTURE IN WENDOVER, NR AYLESBURY, BUCKS Just 23 miles from Oxford, Go Ape Wendover has both a kids' high ropes course and one of our most challenging adults' courses, featuring an optional 'Extreme Route'. FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock Chase is the smallest Area of Outstanding Beauty in mainland Britain and promises to deliver big time fun and adventure. Within an hours’ drive of Birmingham, a stone's throw away from Trentham and easy to reach distance from Leicester, it’s the perfect opportunity to escape the city for the day! FIND ADVENTURE IN SOUTHAMPTON, HAMPSHIRE You’ll find Go Ape Southampton in Itchen Valley Country Park. This 440 acres of beautiful water meadows, woodland and meadows are situated beside the River Itchen and has been recognised by the award of a Green Flag for the past four years. FIND ADVENTURE IN SHERWOOD PINES, NR NOTTINGHAM Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course where the tandem zip wire speedometer can hit 20 mph. Kids are spoilt for choice with a Treetop Adventure course and one of

NETS ADVENTURE

Nets Adventure is a wonderworld of treetop nets, trampolines and much more. This is treetop heaven for children (and adults) with four huge bounce nets (one filled with giant balls and one just for kids), seven canopy tree houses and one destination tree house. GO APE - HIGH ROPES OUTDOOR ACTIVITIES Go Ape is open, pre-booking is essential. The UK's #1 Outdoor Adventure company located at 34 stunning UK locations. Go Ape is home to 9 high rope and and forest floor activities including Treetop Challenge, Treetop Adventure, Forest Segways and Axe Throwing. We also offer Large Group and School events as well as Gift Vouchers and Children's Birthday Parties! FIND ADVENTURE IN BUXTON, DERBYSHIRE Just the journey in to Buxton Go Ape, through the beautiful Peak District National Park, will set the scene of what awaits you. Conveniently located within walking distance from the historic spa town of Buxton, and just under an hour’s drive from Sheffield city centre, you can spend the whole day in England’s largest and oldest

national park.

FIND ADVENTURE IN COVENTRY, WEST MIDLANDS Opened in Spring 2019, Go Ape Coventry offers the best of high rope antics. With a Treetop Challenge, Treetop Adventure Plus and Treetop Adventure, this location has something for thrill-seeking adults and fun-seeking children. FIND ADVENTURE IN CRAWLEY, WEST SUSSEX Our Crawley site is located at Tilgate Park, a few minutes’ drive from the town centre and only a 40-minute drive from Brighton. Set within a park containing a lake, extensive woodlands, multiple activities and a themed restaurant, there is plenty to do. FIND ADVENTURE IN NORMANBY HALL, NR SCUNTHORPE Set in a beautiful 300 acre estate in North Lincolnshire, Go Ape Normamby Hall has two different difficulties available, including Tarzan Swings and Zip Wires. FIND ADVENTURE IN WENDOVER, NR AYLESBURY, BUCKS Just 23 miles from Oxford, Go Ape Wendover has both a kids' high ropes course and one of our most challenging adults' courses, featuring an optional 'Extreme Route'. FIND ADVENTURE IN CANNOCK, NEAR BIRMINGHAM Cannock Chase is the smallest Area of Outstanding Beauty in mainland Britain and promises to deliver big time fun and adventure. Within an hours’ drive of Birmingham, a stone's throw away from Trentham and easy to reach distance from Leicester, it’s the perfect opportunity to escape the city for the day! FIND ADVENTURE IN SOUTHAMPTON, HAMPSHIRE You’ll find Go Ape Southampton in Itchen Valley Country Park. This 440 acres of beautiful water meadows, woodland and meadows are situated beside the River Itchen and has been recognised by the award of a Green Flag for the past four years. FIND ADVENTURE IN SHERWOOD PINES, NR NOTTINGHAM Go Ape Sherwood packs a punch with four brilliant outdoor adventures to get stuck into. Be prepared for some serious speed on the Challenge course where the tandem zip wire speedometer can hit 20 mph. Kids are spoilt for choice with a Treetop Adventure course and one of

NETS ADVENTURE

Nets Adventure is a wonderworld of treetop nets, trampolines and much more. This is treetop heaven for children (and adults) with four huge bounce nets (one filled with giant balls and one just for kids), seven canopy tree houses and one destination tree house. ADVENTURES AT LOCATIONS AND FORESTS ACROSS THE UK See a full list of our 34 breathtaking UK locations. From forests to parks, we’ve picked the best this beautiful country has to offer to give you incredible locations for your Go Ape experience. BOOK YOUR ADVENTURE TODAY Book a Go Ape Adventure and choose from a variety of activities from Treetop Challenge to Axe Throwing at 34 incredible and unique UK

locations.

FIND ADVENTURE IN WYRE, WOCESTERSHIRE 5 miles from Kidderminster and less than 3 miles from Bewdley, Go Ape Wyre has two high ropes courses avaible, suitable for all ages.

NETS ADVENTURE

Nets Adventure is now open and taking bookings! The ultimate adventure playground with sprinkles of some Go Ape magic. Treetop bouncy nets linked by walkways 30 feet above the forest floor. FIND ADVENTURE IN DELAMERE FOREST, NR CHESTER Go Ape Delamere has high ropes courses suitable for all ages, as well as Forest Segways so you can explore the forest in style. Located in Delamere Forest, close to Delamere train station, FIND ADVENTURE IN HALDON FOREST, NR EXETER, DEVON Go Ape Haldon is the gateway to fun and adventure on the moors. You’ll find us 15-minutes from Exeter nestled in 3,500-acres of woodland. Whether sat on top of a tree or moving between sites on the course you’ll get to appreciate the beauty of the Dartmoor

landscape.

JOBS AT GO APE

We're a friendly bunch here at Go Ape, and we believe in rewarding our Tribe accordingly. As well as an exciting environment, we offer our employees a host of benefits including a company contributed pension, workplace nursery scheme, discounted shopping and more. FIND ADVENTURE IN ABERDEEN, SCOTLAND Wildlife fans can enjoy some nature spotting with a walk along the Coy Burn where they may see buzzards, herons and kingfishers. There’s a Wild Wood Adventure Play area for the children with the Green Lady’s Tower, a rock face challenge and a zip wire to zoom between the trees (please note this is free for National Trust for Scotland members and children under the age of 4 and £3 per FIND ADVENTURE IN TEMPLE NEWSAM, NEAR LEEDS There’s a stately feel to Go Ape Temple Newsam, despite being situated just four miles from the centre of Leeds. Based in estate grounds with a 500-year-old country mansion and beautiful woodlands, you’ll feel like Lord and Lady. FIND ADVENTURE IN LEEDS CASTLE, NR MAIDSTONE, KENT Leeds Castle in Maidstone has been described as ‘the loveliest castle in the world’. Home to six queens and Henry VIII himself, the castle is now 900-years-old and offers 500-acres of beautiful parkland and gardens for you and the family to explore. accommodationagearcherybbqbikebikingbirdhidebirthdaysboatingbusinesscarabinercorporatecost-whitecostdisableddogsduration-whitedurationfarmfierce-whitefiercefoodgiftshopgroupsgruffalohalloween marriageminheightminigolfnetsparkingpicnicplatformplayareasafetysavage-whitesavageschoolsegwaysskatesundownsegway sundowntrees tabletennistoiletstrailbikingtreetopadventure treetopadventureplustreetopchallengetreetopsviewpointsvisitorcentrewalkingweightwild-whitewildziplengthziptrekzoo THIS WEBSITE USES COOKIES We use cookies to personalise content and ads, to provide social media features and to analyse our traffic. We also share information about your use of our site with our social media, advertising and analytics partners who may combine it with other information that you’ve provided to them or that they’ve collected from your use of their services. By continuing to use this site, you are agreeing to us

using cookies.

Use necessary cookies only Allow all cookies Show details

OK

Necessary

Preferences

Statistics

Marketing

Show details

Cookie declaration About cookies Necessary (9) Preferences (10) Statistics (8) Marketing (16) Unclassified (1) Necessary cookies help make a website usable by enabling basic functions like page navigation and access to secure areas of the website. The website cannot function properly without these cookies.

NAME

PROVIDER

PURPOSE

EXPIRY

TYPE

CookieConsent

Cookiebot

Stores the user's cookie consent state for the current domain

1 year

HTTP

__cfduid

Nominent

Pingdom

Used by the content network, Cloudflare, to identify trusted web

traffic.

1 year

HTTP

_ok

Olark

Identifies the visitor across devices and visits, in order to optimize the chat-box function on the website.

Session

HTTP

olfsk

Olark

This cookie is necessary for the login function on the website.

2 years

HTTP

pa_enabled

Google Tag Manager

Determines the device used to access the website. This allows the website to be formatted accordingly.

Persistent

HTML

SESS#

Nominent

Preserves users states across page requests.

1 day

HTTP

JSESSIONID

New Relic

Preserves users states across page requests.

Session

HTTP

Preference cookies enable a website to remember information that changes the way the website behaves or looks, like your preferred language or the region that you are in.

NAME

PROVIDER

PURPOSE

EXPIRY

TYPE

CookieConsentBulkSetting-#

Cookiebot

Enables cookie consent across multiple websites

Persistent

HTML

CookieConsentBulkTicket

Cookiebot

Enables cookie consent across multiple websites

1 year

HTTP

_okbk

Olark

Identifies the visitor across devices and visits, in order to optimize the chat-box function on the website.

Session

HTTP

_okck

Olark

Identifies the visitor across devices and visits, in order to optimize the chat-box function on the website.

1 day

HTTP

_okcs

Olark

Identifies the visitor across devices and visits, in order to optimize the chat-box function on the website.

Session

HTTP

_okdetect

Olark

Identifies the visitor across devices and visits, in order to optimize the chat-box function on the website.

Persistent

HTML

_oklv

Olark

Identifies the visitor across devices and visits, in order to optimize the chat-box function on the website.

Session

HTTP

lang

Linkedin

LinkedIn

Set by LinkedIn when a web page contains an embedded "Follow us"

panel.

Session

HTTP

jslog/log.png

Olark

Stores a unique ID string for each chat-box session. This allows the website-support to see previous issues and reconnect with the previous

supporter.

Session

Pixel

Statistic cookies help website owners to understand how visitors interact with websites by collecting and reporting information

anonymously.

NAME

PROVIDER

PURPOSE

EXPIRY

TYPE

_ga

Google Tag Manager

Registers a unique ID that is used to generate statistical data on how the visitor uses the website.

2 years

HTTP

_gat

Google Tag Manager

Used by Google Analytics to throttle request rate

1 day

HTTP

_gid

Google Tag Manager

Registers a unique ID that is used to generate statistical data on how the visitor uses the website.

1 day

HTTP

_hjid

Google Tag Manager

Sets a unique ID for the session. This allows the website to obtain data on visitor behaviour for statistical purposes.

1 year

HTML

hblid

Olark

Identifies the visitor across devices and visits, in order to optimize the chat-box function on the website.

2 years

HTTP

hjViewportId

Google Tag Manager

Sets a unique ID for the session. This allows the website to obtain data on visitor behaviour for statistical purposes.

Session

HTML

pa

Google Tag Manager

Registers the website's speed and performance. This function can be used in context with statistics and load-balancing.

Persistent

HTML

wcsid

Olark

Allows the website to recoqnise the visitor, in order to optimize the chat-box functionality.

Session

HTTP

Marketing cookies are used to track visitors across websites. The intention is to display ads that are relevant and engaging for the individual user and thereby more valuable for publishers and third

party advertisers.

NAME

PROVIDER

PURPOSE

EXPIRY

TYPE

MUID

Microsoft

Used widely by Microsoft as a unique user ID. The cookie enables user tracking by synchronising the ID across many Microsoft domains.

1 year

HTTP

MUIDB

Microsoft

Registers anonymous data on visitors from multiple visits and on multiple websites. This information is used to measure the efficiency of advertisement on websites.

1 year

HTTP

IDE

Google

Used by Google DoubleClick to register and report the website user's actions after viewing or clicking one of the advertiser's ads with the purpose of measuring the efficacy of an ad and to present targeted ads

to the user.

1 year

HTTP

test_cookie

Google

Used to check if the user's browser supports cookies.

1 day

HTTP

fr

Facebook

Used by Facebook to deliver a series of advertisement products such as real time bidding from third party advertisers.

3 months

HTTP

tr

Facebook

Used by Facebook to deliver a series of advertisement products such as real time bidding from third party advertisers.

Session

Pixel

_fbp

Google Tag Manager

Used by Facebook to deliver a series of advertisement products such as real time bidding from third party advertisers.

3 months

HTTP

_gcl_au

Google Tag Manager

Used by Google AdSense for experimenting with advertisement efficiency across websites using their services.

3 months

HTTP

_hjIncludedInSample

Google Tag Manager

Determines if the user's navigation should be registered in a certain statistical place holder.

Session

HTTP

gwcc

Google Tag Manager

Enables Google Website Call Conversions - This registers if the visitor has clicked on call within the "contact us" sub-page. This information is used for statistics and marketing purposes.

3 months

HTTP

ads/ga-audiences

Google

Used by Google AdWords to re-engage visitors that are likely to convert to customers based on the visitor's online behaviour across

websites.

Session

Pixel

bcookie

Linkedin

Used by the social networking service, LinkedIn, for tracking the use of embedded services.

2 years

HTTP

bscookie

Linkedin

Used by the social networking service, LinkedIn, for tracking the use of embedded services.

2 years

HTTP

lidc

Linkedin

Used by the social networking service, LinkedIn, for tracking the use of embedded services.

1 day

HTTP

UserMatchHistory

Linkedin

Used to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences.

29 days

HTTP

pagead/1p-user-list/#

Google

Pending

Session

Pixel

Unclassified cookies are cookies that we are in the process of classifying, together with the providers of individual cookies.

NAME

PROVIDER

PURPOSE

EXPIRY

TYPE

ga.home

Nominent

Pending

Persistent

HTML

Cookies are small text files that can be used by websites to make a user's experience more efficient. The law states that we can store cookies on your device if they are strictly necessary for the operation of this site. For all other types of cookies we need your permission. This site uses different types of cookies. Some cookies are placed by third party services that appear on our pages. Your consent applies to the following domains: goape.local, rroom.net, bookings.goape.co.uk, goape.co.uk Cookie declaration last updated on 12/11/2019 by Cookiebot Skip to main content

Go Ape

Toggle Main Menu Book Now

* Adventures

* Locations

* Groups & Schools

* Gift Vouchers

* Inside Go Ape

Information

* FAQ's

* Go Ape Offers

* Gift Vouchers

* Accessibility

* Terms and Policies

* Privacy Policy

* Cookies

Inside Go Ape

* Our Environment

* Charities

* Blog

* Get In Touch

* Go Ape Jobs

* Facebook

* Instagram

* TrustPilot

* Twitter

* YouTube

Close adventures menu Close adventures menu

Adventures

Close adventures menu

Previous page

*

SUNDOWN TREES

Calling all night owls! You can experience some of our top challenges with an extra dose of added thrill. Limited availability.

* Various

* £18

*

TREETOP CHALLENGE

The Goliath of our high ropes adventures. One to test your nerve and

head for heights.

* Go Moderate/Hard

* 2-3 hours

* £20

*

TREETOP ADVENTURE+

A treetop experience for grown up kids with challenging obstacles, high platforms and long zips

* Go Easy/Moderate

* 1 hour

* £21

*

TREETOP CHALLENGE XPRESS A London high-wire adventure for thrill seekers who want to get their adrenaline-kicks in super quick time.

* Go Moderate/Hard

* 90 minutes

* £20

*

TREETOP ADVENTURE

This experience lasts one hour and is perfect for young adventurers and families looking for some jam-packed fun in the forest canopy.

* Go Easy

* 1 hour

* £18

*

NETS ADVENTURE

Tree houses, netted walkways, bouncy nets full of inflatables balls ALL 30 feet above the forest floor.

* Go Easy

* 2 hours

* £10

*

FOREST SEGWAY

Heavy duty all-terrain Segway + spectacular off-road trails = possibly the most fun you can have on two wheels in the woods.

* Go Moderate

* 1 hour

* £28

*

ZIP TREKKING ADVENTURE One for the zipline fanatics. Seven forest ziplines totalling a whopping 3km. Zip.Wire.Heaven.

* Go Easy/Moderate

* 2-3 hours

* £55

*

AXE THROWING

An exciting new activity in Coventry. Get back to your roots and channel your inner warrior with an hour of stress-busting axe

throwing.

* Go Easy/Moderate

* 1 hour

* £12

Next page

View All Adventures

*

GIFT AN ADVENTURE EXPERIENCE Buy Experience Gift Vouchers Now

Scroll to content

* 1

FIND YOUR NEXT ADVENTURE

Select Activity

ALL ACTIVITIES

* All Activities

* Sundown Trees

* Treetop Challenge

* Treetop Adventure+ * Treetop Challenge Xpress

* Treetop Adventure

* Nets Adventure

* Forest Segway

* Zip Trekking Adventure

* Axe Throwing

All Activities Sundown Trees Treetop Challenge Treetop Adventure+ Treetop Challenge Xpress Treetop Adventure Nets Adventure Forest Segway Zip Trekking Adventure Axe Throwing

Select Location

ALL LOCATIONS

* All Locations

* Aberfoyle

* Alexandra Palace

* Alice Holt

* Battersea Park

* Bedgebury

* Black Park

* Bracknell

* Buxton

* Cannock

* Chessington

* Cockfosters

* Coventry

* Crathes

* Crawley

* Dalby

* Delamere

* Forest of Dean Beechenhurst * Forest of Dean Mallards Pike

* Glentress Forest

* Grizedale

* Haldon

* Leeds Castle, Kent

* Margam

* Matfen

* Moors Valley

* Normanby Hall

* Rivington

* Sherwood

* Southampton

* Temple Newsam

* Thetford Forest

* Wendover

* Whinlatter

* Woburn

* Wyre

All Locations Aberfoyle Alexandra Palace Alice Holt Battersea Park Bedgebury Black Park Bracknell Buxton Cannock Chessington Cockfosters Coventry Crathes Crawley Dalby Delamere Forest of Dean Beechenhurst Forest of Dean Mallards Pike Glentress Forest Grizedale Haldon Leeds Castle, Kent Margam Matfen Moors Valley Normanby Hall Rivington Sherwood Southampton Temple Newsam Thetford Forest Wendover Whinlatter

Woburn Wyre

Search Search

Find Out More

STUDENT DISCOUNTS

Find out more

Find Out More

SEASONAL SAVINGS

Find out more

PICKS OF THE MONTH

Each Go Ape is different. Every month we bring you a selection of our locations, giving you a flavour of the type of adventures you can test your limits on. From mountain forests to urban jungles and easier challenges to the darn right hairy, no two Go Apes are the same.

London

ALEXANDRA PALACE

Sky-high antics meets London’s stunning skyline in one of the capital’s most iconic parks – Ally Pally.

South East

BLACK PARK

The ultimate pick and mix of woodland adventure with a Treetop Challenge, a Treetop Adventure, Forest Segway and Nets Adventure.

North

DALBY

Yorkshire’s fierce and stunning terrain sets the scene for this thrilling high rope experience.

View All Locations

ACTIVITIES FOR EVERY ADVENTURER From tree-to-tree crossings, 3km zip treks, nets 30 feet above the forest floor and heavy duty all-terrain Segway on spectacular off-road trails we have all the adventure boxes ticked. Whether you’re a thrill seeker or after quality family fun come and put a smile on your face, get the wind in your hair and make some memories to last a

lifetime.

*

SUNDOWN TREES

Calling all night owls! You can experience some of our top challenges with an extra dose of added thrill. Limited availability.

* Various

* £18

*

TREETOP CHALLENGE

The Goliath of our high ropes adventures. One to test your nerve and

head for heights.

* Go Moderate/Hard

* 2-3 hours

* £20

*

TREETOP ADVENTURE+

A treetop experience for grown up kids with challenging obstacles, high platforms and long zips

* Go Easy/Moderate

* 1 hour

* £21

*

TREETOP CHALLENGE XPRESS A London high-wire adventure for thrill seekers who want to get their adrenaline-kicks in super quick time.

* Go Moderate/Hard

* 90 minutes

* £20

*

TREETOP ADVENTURE

This experience lasts one hour and is perfect for young adventurers and families looking for some jam-packed fun in the forest canopy.

* Go Easy

* 1 hour

* £18

*

NETS ADVENTURE

Tree houses, netted walkways, bouncy nets full of inflatables balls ALL 30 feet above the forest floor.

* Go Easy

* 2 hours

* £10

*

FOREST SEGWAY

Heavy duty all-terrain Segway + spectacular off-road trails = possibly the most fun you can have on two wheels in the woods.

* Go Moderate

* 1 hour

* £28

*

ZIP TREKKING ADVENTURE One for the zipline fanatics. Seven forest ziplines totalling a whopping 3km. Zip.Wire.Heaven.

* Go Easy/Moderate

* 2-3 hours

* £55

*

AXE THROWING

An exciting new activity in Coventry. Get back to your roots and channel your inner warrior with an hour of stress-busting axe

throwing.

* Go Easy/Moderate

* 1 hour

* £12

Next page

View All Adventures

THE GO APE EXPERIENCE

Previous page

*

> Excellent day out with the kids. It is pricey, but worth it when you > see there confidence grow and there faces light up.

Asad Lodhi

*

> We had an outstanding experience on the high ropes Jr course. All > staff were brilliant with our students, both supportive and patient. > We all look forward to going again soon.

Neil Dyke

*

> Despite the rain it was still enjoyable & the instructors were

> fantastic.

LEIGHOG

*

> Had a great trip, particularly the dual tarzan swing near the end.

John Methven

*

> Very good experience although the website was confusing as we had > booked the wrong one. Also the poor signage at the entrance > (Wendover) meant it took a few goes to find it!

JOHN CUNNINGHAM

*

> Great fun for my 14 year old

customer

Next page

THE GO APE STORY

Days out at Go Ape are about living life more adventurously, having fun, spending time with friends and getting in touch with your inner adventurer. Find out how we do this and how we became the UK’s number one forest adventure available in 34 of the UK's most breathtaking locations.

Discover More

INSIDE GO APE

Blog

GO LATE AT GO APE

This autumn, thrill seekers are invited to leap, fly, run or zoom their way through a new night-time adventure. Don't miss out!

Blog

ONE WOMAN'S 34 SITE CHALLENGE Verity Bailes has now zipped into the record books as the first woman to complete all 34 outdoor adventure sites in the UK!

Blog

OUR TOP 5 GO APE OBSTACLES For a limited time only, the popular Go Ape adventure attraction is being turned into something spooky this Halloween. READY TO DISCOVER ADVENTURE?

Take the Leap

ADVENTURES

* Treetop Challenge

* Treetop Adventure+

* Treetop Adventure

* Nets Adventure

* Forest Segway

* Zip Trekking Adventure

REGIONS

* London

* South East

* Scotland

* North

* Midlands

* Wales

* South West

INSIDE GO APE

* Our Environment

* Charities

* Blog

* Get In Touch

* Go Ape Jobs

INFORMATION

* FAQ's

* Go Ape Offers

* Gift Vouchers

* Accessibility

* Terms and Policies

* Privacy Policy

* Cookies

Share your Go Ape experiences with the world. Tag @GoApeTribe or #GoApe to inspire our digital jungle. We're a social tribe, connect

with us...

* Facebook

* Instagram

* TrustPilot

* Twitter

* YouTube

© 2019 Go Ape. All rights reserved.

To Top